SCOPe 2.08: Domain d6fr5a2: 6fr5 A:114-203

Lineage for d6fr5a2 (6fr5 A:114-203)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6fr5a2: 6fr5 A:114-203 [351239]
   Other proteins in same PDB: d6fr5a1, d6fr5b1, d6fr5b2
   automated match to d2pyfa2
   complexed with act, edo, gol

Details for d6fr5a2

PDB Entry: 6fr5, 1.37 Å

PDB Description: ha1.7 tcr study of cdr loop flexibility

PDB Compounds: (A:) TCR HA1.7 specific for FLU epitope PKYVKQNTLKLAT, alpha chain

SCOPe Domain Sequences for d6fr5a2:

Sequence; same for both SEQRES and ATOM records:

>d6fr5a2 b.1.1.2 (A:114-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Timeline for d6fr5a2:

• d6fr5a2 first appeared in SCOPe 2.07