SCOP 1.67: Domain d5at1a2: 5at1 A:151-310

Lineage for d5at1a2 (5at1 A:151-310)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (3 species)

7. Species Escherichia coli [TaxId:562] [53674] (30 PDB entries)

8. Domain d5at1a2: 5at1 A:151-310 [35117]
   Other proteins in same PDB: d5at1b1, d5at1b2, d5at1d1, d5at1d2

Details for d5at1a2

PDB Entry: 5at1, 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

SCOP Domain Sequences for d5at1a2:

Sequence; same for both SEQRES and ATOM records:

>d5at1a2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampeyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

Timeline for d5at1a2:

• d5at1a2 first appeared (with stable ids) in SCOP 1.55
  
• d5at1a2 appears in SCOP 1.65
  
• d5at1a2 appears in SCOP 1.69
  
• d5at1a2 appears in the current release, SCOPe 2.08