Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.0: automated matches [191636] (1 protein) not a true family |
Protein automated matches [191172] (11 species) not a true protein |
Species Escherichia coli [TaxId:562] [256126] (6 PDB entries) |
Domain d6en9s_: 6en9 S: [351157] Other proteins in same PDB: d6en9l_, d6en9m_ automated match to d3myra_ complexed with f3s, fco, mg, ni, sf4, so4 |
PDB Entry: 6en9 (more details), 1.5 Å
SCOPe Domain Sequences for d6en9s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6en9s_ e.19.1.0 (S:) automated matches {Escherichia coli [TaxId: 562]} qrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghqveenkhnal ekykgqyvlvvdgsiplkdngiycmvagepivdhirkaaegaaaiiaigscsawggvaaa gvnptgavslqevlpgktvinipgcppnphnflatvahiitygkppklddknrptfaygr lihehcerrphfdagrfakefgdeghregwclyhlgckgpetygncstlqfcdvggvwpv aighpcygcneegigfhkgihqlanve
Timeline for d6en9s_: