SCOP 1.67: Domain d6at1c1: 6at1 C:1-150

Lineage for d6at1c1 (6at1 C:1-150)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (3 species)

7. Species Escherichia coli [TaxId:562] [53674] (30 PDB entries)

8. Domain d6at1c1: 6at1 C:1-150 [35114]
   Other proteins in same PDB: d6at1b1, d6at1b2, d6at1d1, d6at1d2

Details for d6at1c1

PDB Entry: 6at1, 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

SCOP Domain Sequences for d6at1c1:

Sequence; same for both SEQRES and ATOM records:

>d6at1c1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfq
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqqteg

Timeline for d6at1c1:

• d6at1c1 first appeared (with stable ids) in SCOP 1.55
  
• d6at1c1 appears in SCOP 1.65
  
• d6at1c1 appears in SCOP 1.69
  
• d6at1c1 appears in the current release, SCOPe 2.08