SCOPe 2.08: Domain d5vjqd1: 5vjq D:1-107

Lineage for d5vjqd1 (5vjq D:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5vjqd1: 5vjq D:1-107 [351101]
   Other proteins in same PDB: d5vjqa_, d5vjqb2, d5vjqc_, d5vjqd2, d5vjqe_, d5vjqf2, d5vjqg_, d5vjqh2, d5vjqi_, d5vjqj_, d5vjqk_, d5vjql_
   automated match to d2fd6l1
   complexed with cl, gol; mutant

Details for d5vjqd1

PDB Entry: 5vjq, 1.9 Å

PDB Description: complex between hyhel10 fab fragment heavy chain mutant (i29f, s52t, y53f) and pekin duck egg lysozyme isoform i (del-i)

PDB Compounds: (D:) HyHEL10 light chain Fab fragment

SCOPe Domain Sequences for d5vjqd1:

Sequence; same for both SEQRES and ATOM records:

>d5vjqd1 b.1.1.0 (D:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

Timeline for d5vjqd1:

• d5vjqd1 first appeared in SCOPe 2.07