Lineage for d1f1bc2 (1f1b C:151-310)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) 
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) 
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species) 
Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
Uniprot P00479
Domain d1f1bc2: 1f1b C:151-310 [35107]
Other proteins in same PDB: d1f1bb1, d1f1bb2, d1f1bd1, d1f1bd2
complexed with pal, zn; mutant
Details for d1f1bc2
PDB Entry: 1f1b (more details), 2.3 Å
PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the r-state in the presence of n-phosphonacetyl-l-aspartate
PDB Compounds: (C:) Aspartate carbamoyltransferase catalytic chainSCOPe Domain Sequences for d1f1bc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f1bc2 c.78.1.1 (C:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplarv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl
SCOPe Domain Coordinates for d1f1bc2:
Click to download the PDB-style file with coordinates for d1f1bc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f1bc2:
View in 3D
