SCOPe 2.08: Domain d5vjob1: 5vjo B:1-107

Lineage for d5vjob1 (5vjo B:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5vjob1: 5vjo B:1-107 [351050]
   Other proteins in same PDB: d5vjoa_, d5vjob2, d5vjoc_, d5vjod2, d5vjoe_, d5vjof_
   automated match to d4m43l1
   complexed with cl, na; mutant

Details for d5vjob1

PDB Entry: 5vjo, 2.43 Å

PDB Description: complex between hyhel10 fab fragment heavy chain mutant i29f and pekin duck egg lysozyme isoform i (del-i)

PDB Compounds: (B:) HyHEL10 light chain Fab fragment

SCOPe Domain Sequences for d5vjob1:

Sequence; same for both SEQRES and ATOM records:

>d5vjob1 b.1.1.0 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

Timeline for d5vjob1:

• d5vjob1 first appeared in SCOPe 2.07