Lineage for d5z9yb_ (5z9y B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2426052Superfamily c.1.31: ThiG-like [110399] (2 families) (S)
    shares the common phosphate-binding site with other superfamilies
  5. 2426065Family c.1.31.0: automated matches [191453] (1 protein)
    not a true family
  6. 2426066Protein automated matches [190693] (3 species)
    not a true protein
  7. 3050968Species Mycobacterium tuberculosis [TaxId:83332] [351030] (1 PDB entry)
  8. 3050970Domain d5z9yb_: 5z9y B: [351032]
    automated match to d1xm3c_
    complexed with dxp

Details for d5z9yb_

PDB Entry: 5z9y (more details), 1.48 Å

PDB Description: crystal structure of mycobacterium tuberculosis thiazole synthase (thig) complexed with dxp
PDB Compounds: (B:) Thiazole synthase

SCOPe Domain Sequences for d5z9yb_:

Sequence, based on SEQRES records: (download)

>d5z9yb_ c.1.31.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
klvigdrsfasrlimgtggatnlavleqaliasgtelttvairrvdadggtglldllnrl
gitplpntagsrsaaeavltaqlarealntnwvkleviadertlwpdavelvraaeqlvd
dgfvvlpyttddpvlarrledtgcaavmplgspigtglgianphniemivagarvpvvld
agigtasdaalamelgcdavllasavtraadppamaaamaaavtagylarcagripkrfw
aqa

Sequence, based on observed residues (ATOM records): (download)

>d5z9yb_ c.1.31.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
klvigdrsfasrlimgtggatnlavleqaliasgtelttvaiglldllnrlgitplpnta
gsrsaaeavltaqlarealntnwvkleviadertlwpdavelvraaeqlvddgfvvlpyt
tddpvlarrledtgcaavmplgspigtglgianphniemivagarvpvvldagigtasda
alamelgcdavllasavtraadppamaaamaaavtagylarcagripkrfwaqa

SCOPe Domain Coordinates for d5z9yb_:

Click to download the PDB-style file with coordinates for d5z9yb_.
(The format of our PDB-style files is described here.)

Timeline for d5z9yb_:

  • d5z9yb_ is new in SCOPe 2.07-stable