SCOPe 2.08: Domain d5xjvb_: 5xjv B:

Lineage for d5xjvb_ (5xjv B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)

8. Domain d5xjvb_: 5xjv B: [350966]
   automated match to d2y96a_
   complexed with po4

Details for d5xjvb_

PDB Entry: 5xjv, 1.69 Å

PDB Description: two intermediate states of conformation switch in dual specificity phosphatase 13a

PDB Compounds: (B:) Dual specificity protein phosphatase 13 isoform A

SCOPe Domain Sequences for d5xjvb_:

Sequence; same for both SEQRES and ATOM records:

>d5xjvb_ c.45.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atpapsileleellragkssasrvdevwpnlfigdaatannrfelwklgithvlnaahkg
lyaqggpdfygssvsylgvpahdlpdfdisayfssaadfihralntpgakvlvhsvvgvs
rsatlvlaylmlhqrlslrqavitvrqhrwvfpnrgflhqlarldqqlrga

Timeline for d5xjvb_:

• d5xjvb_ first appeared in SCOPe 2.07