SCOPe 2.08: Domain d6elia2: 6eli A:430-554

Lineage for d6elia2 (6eli A:430-554)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11678] [261468] (27 PDB entries)

8. Domain d6elia2: 6eli A:430-554 [350958]
   Other proteins in same PDB: d6elia1, d6elib_
   automated match to d1dloa1
   protein/DNA complex; complexed with ba5, edo, mg, so4, t27

Details for d6elia2

PDB Entry: 6eli, 2.2 Å

PDB Description: structure of hiv-1 reverse transcriptase (rt) in complex with rilpivirine and an rnase h inhibitor xz462

PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d6elia2:

Sequence; same for both SEQRES and ATOM records:

>d6elia2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Timeline for d6elia2:

• d6elia2 first appeared in SCOPe 2.07