Lineage for d5w0ha1 (5w0h A:258-336)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) 
Family d.58.7.1: Canonical RBD [54929] (70 proteins)
Pfam PF00076
Pfam PF13893
Protein Splicing factor U2AF 65 KDa subunit [54936] (2 species) Species Human (Homo sapiens) [TaxId:9606] [54937] (10 PDB entries) 
Domain d5w0ha1: 5w0h A:258-336 [350948]
Other proteins in same PDB: d5w0ha2
automated match to d1d8za_
protein/RNA complex
Details for d5w0ha1
PDB Entry: 5w0h (more details), 1.11 Å
PDB Description: structure of u2af65 (u2af2) rrm2 at 1.11 angstrom resolution
PDB Compounds: (A:) splicing factor u2af 65 kda subunitSCOPe Domain Sequences for d5w0ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w0ha1 d.58.7.1 (A:258-336) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}
ahklfigglpnylnddqvkelltsfgplkafnlvkdsatglskgyafceyvdinvtdqai
aglngmqlgdkkllvqras
SCOPe Domain Coordinates for d5w0ha1:
Click to download the PDB-style file with coordinates for d5w0ha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5w0ha1:
- d5w0ha1 first appeared in SCOPe 2.07
View in 3D
