Lineage for d6et5h2 (6et5 H:37-258)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384684Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2384685Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2384686Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 2384805Protein automated matches [226918] (3 species)
    not a true protein
  7. 2384806Species Blastochloris viridis [TaxId:1079] [232267] (5 PDB entries)
  8. 3050867Domain d6et5h2: 6et5 H:37-258 [350929]
    Other proteins in same PDB: d6et51_, d6et54_, d6et57_, d6et5c_, d6et5f_, d6et5g_, d6et5h1, d6et5i_, d6et5l_, d6et5m_, d6et5n_, d6et5o_, d6et5q_, d6et5r_, d6et5t_, d6et5u_, d6et5w_, d6et5x_, d6et5z_
    automated match to d2wjnh2
    complexed with bcb, bpb, fe, hem, lda, mq9, ns0, ns5, so4, uq9

Details for d6et5h2

PDB Entry: 6et5 (more details), 3 Å

PDB Description: reaction centre light harvesting complex 1 from blc. virids
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d6et5h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6et5h2 b.41.1.1 (H:37-258) automated matches {Blastochloris viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

SCOPe Domain Coordinates for d6et5h2:

Click to download the PDB-style file with coordinates for d6et5h2.
(The format of our PDB-style files is described here.)

Timeline for d6et5h2: