Lineage for d6et5h1 (6et5 H:1-36)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578573Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 2578693Family f.23.10.0: automated matches [227192] (1 protein)
    not a true family
  6. 2578694Protein automated matches [226917] (3 species)
    not a true protein
  7. 2578695Species Blastochloris viridis [TaxId:1079] [232250] (5 PDB entries)
  8. 3050866Domain d6et5h1: 6et5 H:1-36 [350928]
    Other proteins in same PDB: d6et51_, d6et54_, d6et57_, d6et5c_, d6et5f_, d6et5g_, d6et5h2, d6et5i_, d6et5l_, d6et5m_, d6et5n_, d6et5o_, d6et5q_, d6et5r_, d6et5t_, d6et5u_, d6et5w_, d6et5x_, d6et5z_
    automated match to d2wjnh1
    complexed with bcb, bpb, fe, hem, lda, mq9, ns0, ns5, so4, uq9

Details for d6et5h1

PDB Entry: 6et5 (more details), 3 Å

PDB Description: reaction centre light harvesting complex 1 from blc. virids
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d6et5h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6et5h1 f.23.10.0 (H:1-36) automated matches {Blastochloris viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOPe Domain Coordinates for d6et5h1:

Click to download the PDB-style file with coordinates for d6et5h1.
(The format of our PDB-style files is described here.)

Timeline for d6et5h1: