SCOPe 2.08: Domain d6et5h1: 6et5 H:1-36

Lineage for d6et5h1 (6et5 H:1-36)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families)

5. Family f.23.10.0: automated matches [227192] (1 protein)
   not a true family

6. Protein automated matches [226917] (6 species)
   not a true protein

7. Species Blastochloris viridis [TaxId:1079] [232250] (5 PDB entries)

8. Domain d6et5h1: 6et5 H:1-36 [350928]
   Other proteins in same PDB: d6et51_, d6et53_, d6et54_, d6et56_, d6et57_, d6et5b_, d6et5c_, d6et5e_, d6et5f_, d6et5g_, d6et5h2, d6et5i_, d6et5k_, d6et5l_, d6et5m_, d6et5n_, d6et5o_, d6et5p_, d6et5q_, d6et5r_, d6et5s_, d6et5t_, d6et5u_, d6et5v_, d6et5w_, d6et5x_, d6et5y_, d6et5z_
   automated match to d2wjnh1
   complexed with bcb, bpb, fe, hem, lda, mq9, ns0, ns5, so4, uq9

Details for d6et5h1

PDB Entry: 6et5, 3 Å

PDB Description: reaction centre light harvesting complex 1 from blc. virids

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d6et5h1:

Sequence; same for both SEQRES and ATOM records:

>d6et5h1 f.23.10.0 (H:1-36) automated matches {Blastochloris viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

Timeline for d6et5h1:

• d6et5h1 first appeared in SCOPe 2.07