Lineage for d6fmie_ (6fmi E:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513278Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2513355Protein Elongin C [54699] (3 species)
  7. 2513358Species Human (Homo sapiens) [TaxId:9606] [54700] (52 PDB entries)
  8. 3050863Domain d6fmie_: 6fmi E: [350925]
    Other proteins in same PDB: d6fmia_, d6fmic_, d6fmid_, d6fmif_
    automated match to d1lm8c_
    complexed with dv2

Details for d6fmie_

PDB Entry: 6fmi (more details), 2.8 Å

PDB Description: pvhl:elob:eloc in complex with n-((s)-1-((2s,4r)-4-hydroxy-2-((4-(4- methylthiazol-5-yl)benzyl)carbamothioyl) pyrrolidin-1-yl)-1- oxopropan-2-yl)acetamide (ligand 2)
PDB Compounds: (E:) Elongin-C

SCOPe Domain Sequences for d6fmie_:

Sequence, based on SEQRES records: (download)

>d6fmie_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d6fmie_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d6fmie_:

Click to download the PDB-style file with coordinates for d6fmie_.
(The format of our PDB-style files is described here.)

Timeline for d6fmie_: