Lineage for d5vfab2 (5vfa B:135-229)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2307689Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2307775Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2307776Protein automated matches [190858] (19 species)
    not a true protein
  7. 3050857Species Streptococcus pneumoniae [TaxId:171101] [350919] (1 PDB entry)
  8. 3050858Domain d5vfab2: 5vfa B:135-229 [350920]
    Other proteins in same PDB: d5vfaa1, d5vfaa3, d5vfab1, d5vfab3
    automated match to d1kgsa1
    mutant

Details for d5vfab2

PDB Entry: 5vfa (more details), 1.45 Å

PDB Description: ritr mutant - c128d
PDB Compounds: (B:) Response regulator

SCOPe Domain Sequences for d5vfab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vfab2 a.4.6.0 (B:135-229) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
rtyrnlridvehhtvyrgeemialtrreydllatlmgskkvltreqllesvwkyesatet
nivdvyirylrskldvkgqksyiktvrgvgytmqe

SCOPe Domain Coordinates for d5vfab2:

Click to download the PDB-style file with coordinates for d5vfab2.
(The format of our PDB-style files is described here.)

Timeline for d5vfab2:

  • d5vfab2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-12