Lineage for d6ekib_ (6eki B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811457Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2811458Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2812758Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2812759Protein automated matches [191011] (16 species)
    not a true protein
  7. 2812951Species Persephonella marina [TaxId:309805] [350833] (1 PDB entry)
  8. 2812953Domain d6ekib_: 6eki B: [350906]
    automated match to d4coqb_
    complexed with zn

Details for d6ekib_

PDB Entry: 6eki (more details), 2.56 Å

PDB Description: structure of a hyperthermostable carbonic anhydrase identified from an active hydrothermal vent chimney
PDB Compounds: (B:) carbonic anhydrase

SCOPe Domain Sequences for d6ekib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ekib_ b.74.1.0 (B:) automated matches {Persephonella marina [TaxId: 309805]}
hwsyhgetgpqhwgdlkneyimckigknqspvdisriveaelekikinyssggssitnng
htikvsyepgsyiivdgirfelkqfhfhapsehtikgksypfeahfvhadkdgnlavigv
ifkegkknpiiekiwenlpeagktiklahkinaydllpkkkkyyrysgslttppcsegvr
wivmeeemelskeqiekfrklmggdtnrpvqplnarmimemd

SCOPe Domain Coordinates for d6ekib_:

Click to download the PDB-style file with coordinates for d6ekib_.
(The format of our PDB-style files is described here.)

Timeline for d6ekib_: