Lineage for d6fmki_ (6fmk I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768792Protein VHL [49470] (1 species)
  7. 2768793Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)
  8. 2768915Domain d6fmki_: 6fmk I: [350870]
    Other proteins in same PDB: d6fmka_, d6fmkb1, d6fmkb2, d6fmkd_, d6fmke1, d6fmke2, d6fmkg_, d6fmkh1, d6fmkh2, d6fmkj_, d6fmkk1, d6fmkk2
    automated match to d1lm8v_
    complexed with dv8

Details for d6fmki_

PDB Entry: 6fmk (more details), 2.75 Å

PDB Description: pvhl:elob:eloc in complex with n-((s)-1-((2s,4r)-4-hydroxy-2-((4-(4- methylthiazol-5-yl)benzyl)carbamothioyl) pyrrolidin-1-yl)-1- thioxopropan-2-yl)acetamide (ligand 4)
PDB Compounds: (I:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d6fmki_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fmki_ b.3.3.1 (I:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d6fmki_:

Click to download the PDB-style file with coordinates for d6fmki_.
(The format of our PDB-style files is described here.)

Timeline for d6fmki_: