Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
Domain d6fmkf_: 6fmk F: [350855] Other proteins in same PDB: d6fmka_, d6fmkb1, d6fmkb2, d6fmkd_, d6fmke1, d6fmke2, d6fmkg_, d6fmkh1, d6fmkh2, d6fmkj_, d6fmkk1, d6fmkk2 automated match to d1lm8v_ complexed with dv8 |
PDB Entry: 6fmk (more details), 2.75 Å
SCOPe Domain Sequences for d6fmkf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fmkf_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqe
Timeline for d6fmkf_: