Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
Domain d6fmkd_: 6fmk D: [350846] Other proteins in same PDB: d6fmkb1, d6fmkb2, d6fmkc_, d6fmke1, d6fmke2, d6fmkf_, d6fmkh1, d6fmkh2, d6fmki_, d6fmkk1, d6fmkk2, d6fmkl_ automated match to d1lqba_ complexed with dv8 |
PDB Entry: 6fmk (more details), 2.75 Å
SCOPe Domain Sequences for d6fmkd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fmkd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d6fmkd_: