Lineage for d6et5m_ (6et5 M:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579766Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2579767Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2579768Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2579961Protein automated matches [190224] (9 species)
    not a true protein
  7. 2579962Species Blastochloris viridis [TaxId:1079] [187141] (8 PDB entries)
  8. 3050779Domain d6et5m_: 6et5 M: [350841]
    Other proteins in same PDB: d6et51_, d6et54_, d6et57_, d6et5c_, d6et5f_, d6et5g_, d6et5h1, d6et5h2, d6et5i_, d6et5l_, d6et5n_, d6et5o_, d6et5q_, d6et5r_, d6et5t_, d6et5u_, d6et5w_, d6et5x_, d6et5z_
    automated match to d3g7fm_
    complexed with bcb, bpb, fe, hem, lda, mq9, ns0, ns5, so4, uq9

Details for d6et5m_

PDB Entry: 6et5 (more details), 3 Å

PDB Description: reaction centre light harvesting complex 1 from blc. virids
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d6et5m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6et5m_ f.26.1.1 (M:) automated matches {Blastochloris viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

SCOPe Domain Coordinates for d6et5m_:

Click to download the PDB-style file with coordinates for d6et5m_.
(The format of our PDB-style files is described here.)

Timeline for d6et5m_: