Lineage for d6et5c_ (6et5 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339824Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2339825Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2339933Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
    consists of four heme-binding repeats
    automatically mapped to Pfam PF02276
  6. 2339959Protein automated matches [227073] (3 species)
    not a true protein
  7. 2339960Species Blastochloris viridis [TaxId:1079] [226253] (2 PDB entries)
  8. 3050770Domain d6et5c_: 6et5 C: [350832]
    Other proteins in same PDB: d6et51_, d6et54_, d6et57_, d6et5f_, d6et5g_, d6et5h1, d6et5h2, d6et5i_, d6et5l_, d6et5m_, d6et5n_, d6et5o_, d6et5q_, d6et5r_, d6et5t_, d6et5u_, d6et5w_, d6et5x_, d6et5z_
    automated match to d3t6dc_
    complexed with bcb, bpb, fe, hem, lda, mq9, ns0, ns5, so4, uq9

Details for d6et5c_

PDB Entry: 6et5 (more details), 3 Å

PDB Description: reaction centre light harvesting complex 1 from blc. virids
PDB Compounds: (C:) Photosynthetic reaction center cytochrome c subunit

SCOPe Domain Sequences for d6et5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6et5c_ a.138.1.2 (C:) automated matches {Blastochloris viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpika

SCOPe Domain Coordinates for d6et5c_:

Click to download the PDB-style file with coordinates for d6et5c_.
(The format of our PDB-style files is described here.)

Timeline for d6et5c_: