Lineage for d6ax8a1 (6ax8 A:1-351)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.0: automated matches [191377] (1 protein)
not a true familyProtein automated matches [190459] (61 species)
not a true protein
Species Mycobacterium tuberculosis [TaxId:83332] [269137] (14 PDB entries) 
Domain d6ax8a1: 6ax8 A:1-351 [350815]
Other proteins in same PDB: d6ax8a2
automated match to d2x1la1
protein/RNA complex; complexed with me8
Details for d6ax8a1
PDB Entry: 6ax8 (more details), 2.6 Å
PDB Description: mycobacterium tuberculosis methionyl-trna synthetase in complex with methionyl-adenylate
PDB Compounds: (A:) Methionine-tRNA ligaseSCOPe Domain Sequences for d6ax8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ax8a1 c.26.1.0 (A:1-351) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mkpyyvttaiaypnaaphvghayeyiatdaiarfkrldrydvrfltgtdehglkvaqaaa
aagvptaalarrnsdvfqrmqealnisfdrfirttdadhheaskelwrrmsaagdiyldn
ysgwysvrderffvesetqlvdgtrltvetgtpvtwteeqtyffrlsaytdkllahyhan
pdfiapetrrnevisfvsgglddlsisrtsfdwgvqvpehpdhvmyvwvdaltnyltgag
fpdtdselfrrywpadlhmigkdiirfhavywpaflmsagielprrifahgflhnrgekm
sksvgnivdpvalaealgvdqvryfllrevpfgqdgsysdeaivtrintdl
SCOPe Domain Coordinates for d6ax8a1:
Click to download the PDB-style file with coordinates for d6ax8a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6ax8a1:
- d6ax8a1 first appeared in SCOPe 2.07
View in 3D
