Lineage for d6fkld2 (6fkl D:246-440)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525532Species Cow (Bos taurus) [TaxId:9913] [226565] (61 PDB entries)
  8. 3050738Domain d6fkld2: 6fkl D:246-440 [350800]
    Other proteins in same PDB: d6fkla1, d6fklb1, d6fklc1, d6fkld1, d6fkle_, d6fklf1, d6fklf2, d6fklf3
    automated match to d3rycd2
    complexed with acp, ca, dlk, gdp, gol, gtp, mes, mg

Details for d6fkld2

PDB Entry: 6fkl (more details), 2.1 Å

PDB Description: tubulin-tub015 complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6fkld2:

Sequence, based on SEQRES records: (download)

>d6fkld2 d.79.2.1 (D:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdata

Sequence, based on observed residues (ATOM records): (download)

>d6fkld2 d.79.2.1 (D:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsaltvpeltqqmfdsknmmaacdprhgry
ltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfign
staiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdata

SCOPe Domain Coordinates for d6fkld2:

Click to download the PDB-style file with coordinates for d6fkld2.
(The format of our PDB-style files is described here.)

Timeline for d6fkld2:

  • d6fkld2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08