Lineage for d6fe4d_ (6fe4 D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2381771Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2381772Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 protein domains)
  6. 2382264Protein automated matches [190381] (10 species)
    not a true protein
  7. 3050479Species Enterobacteria phage [TaxId:10730] [350541] (1 PDB entry)
  8. 3050714Domain d6fe4d_: 6fe4 D: [350776]
    Other proteins in same PDB: d6fe4a2, d6fe4b2, d6fe4c2, d6fe4e2, d6fe4f1, d6fe4f2, d6fe4g1, d6fe4g2, d6fe4h1, d6fe4h2, d6fe4i1, d6fe4i2, d6fe4j1, d6fe4j2
    automated match to d2ga4b_

Details for d6fe4d_

PDB Entry: 6fe4 (more details), 3 Å

PDB Description: crystal structure of the complex between shiga toxin stx2 b subunit and neutralising nb113
PDB Compounds: (D:) Shiga-like toxin 2 subunit B

SCOPe Domain Sequences for d6fe4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fe4d_ b.40.2.1 (D:) automated matches {Enterobacteria phage [TaxId: 10730]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd

SCOPe Domain Coordinates for d6fe4d_:

Click to download the PDB-style file with coordinates for d6fe4d_.
(The format of our PDB-style files is described here.)

Timeline for d6fe4d_:

  • d6fe4d_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08