Lineage for d6fe4j1 (6fe4 J:6-116)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (19 species)
    not a true protein
  7. 2348290Species Vicugna pacos [TaxId:30538] [189756] (41 PDB entries)
  8. 3050702Domain d6fe4j1: 6fe4 J:6-116 [350764]
    Other proteins in same PDB: d6fe4a1, d6fe4a2, d6fe4b1, d6fe4b2, d6fe4c1, d6fe4c2, d6fe4d_, d6fe4e1, d6fe4e2, d6fe4f2, d6fe4g2, d6fe4h2, d6fe4i2, d6fe4j2
    automated match to d6eqib_

Details for d6fe4j1

PDB Entry: 6fe4 (more details), 3 Å

PDB Description: crystal structure of the complex between shiga toxin stx2 b subunit and neutralising nb113
PDB Compounds: (J:) Nb113

SCOPe Domain Sequences for d6fe4j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fe4j1 b.1.1.1 (J:6-116) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqpggslrlscaasgftfssyymswvrqapgkgpewvsgintggvgtryadsvk
grftisrdnakntlylqmnslkpedtalyycaigeggnrnywgqgtqvtvs

SCOPe Domain Coordinates for d6fe4j1:

Click to download the PDB-style file with coordinates for d6fe4j1.
(The format of our PDB-style files is described here.)

Timeline for d6fe4j1:

  • d6fe4j1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08