Lineage for d6fnua1 (6fnu A:1-301)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2425802Superfamily c.1.23: FAD-linked oxidoreductase [51730] (3 families) (S)
    distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation
  5. 3050697Family c.1.23.0: automated matches [350759] (1 protein)
    not a true family
  6. 3050698Protein automated matches [350760] (1 species)
    not a true protein
  7. 3050699Species Saccharomyces cerevisiae [TaxId:4932] [350761] (1 PDB entry)
  8. 3050700Domain d6fnua1: 6fnu A:1-301 [350762]
    Other proteins in same PDB: d6fnua2
    automated match to d3apya_
    complexed with fad

Details for d6fnua1

PDB Entry: 6fnu (more details), 1.56 Å

PDB Description: structure of s. cerevisiae methylenetetrahydrofolate reductase 1, catalytic domain
PDB Compounds: (A:) Methylenetetrahydrofolate reductase 1

SCOPe Domain Sequences for d6fnua1:

Sequence, based on SEQRES records: (download)

>d6fnua1 c.1.23.0 (A:1-301) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
msirdlyharaspfisleffppktelgtrnlmermhrmtaldplfitvtwgaggttaekt
ltlaslaqqtlnipvcmhltctntekaiiddaldrcynagirnilalrgdppigedwlds
qsnespfkyavdlvryikqsygdkfcvgvaaypeghcegeaegheqdplkdlvylkekve
agadfvitqlfydvekfltfemlfrerisqdlplfpglmpinsyllfhraaklshasipp
ailsrfppeiqsddnavksigvdilieliqeiyqrtsgrikgfhfytlnlekaiaqivsq
s

Sequence, based on observed residues (ATOM records): (download)

>d6fnua1 c.1.23.0 (A:1-301) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
msirdlyharaspfisleffppktelgtrnlmermhrmtaldplfitvtwgaggttaekt
ltlaslaqqtlnipvcmhltctntekaiiddaldrcynagirnilalrgdppigedwlds
pfkyavdlvryikqsygdkfcvgvaaypeghcegqdplkdlvylkekveagadfvitqlf
ydvekfltfemlfrerisqdlplfpglmpinsyllfhraaklshasippailsrfppeiq
sddnavksigvdilieliqeiyqrtsgrikgfhfytlnlekaiaqivsqs

SCOPe Domain Coordinates for d6fnua1:

Click to download the PDB-style file with coordinates for d6fnua1.
(The format of our PDB-style files is described here.)

Timeline for d6fnua1:

  • d6fnua1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6fnua2