Lineage for d6fi0a_ (6fi0 A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588901Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 2588902Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 2589001Family g.50.1.0: automated matches [191482] (1 protein)
    not a true family
  6. 2589002Protein automated matches [190772] (5 species)
    not a true protein
  7. 2589007Species Human (Homo sapiens) [TaxId:9606] [187998] (25 PDB entries)
  8. 3050682Domain d6fi0a_: 6fi0 A: [350744]
    automated match to d4q6fa_
    complexed with dew, gol, k, po4, zn

Details for d6fi0a_

PDB Entry: 6fi0 (more details), 1.9 Å

PDB Description: crystal structure of baz2a phd zinc finger in complex with fr 19
PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2A

SCOPe Domain Sequences for d6fi0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fi0a_ g.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv

SCOPe Domain Coordinates for d6fi0a_:

Click to download the PDB-style file with coordinates for d6fi0a_.
(The format of our PDB-style files is described here.)

Timeline for d6fi0a_:

  • d6fi0a_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08