Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) consists of clearly related families of somewhat different folds |
Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (3 proteins) typical (beta/alpha)8-barrel fold heterodimer of two similar chains |
Protein automated matches [191049] (2 species) not a true protein |
Species Photobacterium leiognathi [TaxId:553611] [350643] (1 PDB entry) |
Domain d6fria_: 6fri A: [350720] automated match to d3fgcb_ complexed with act |
PDB Entry: 6fri (more details), 2.3 Å
SCOPe Domain Sequences for d6fria_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fria_ c.1.16.1 (A:) automated matches {Photobacterium leiognathi [TaxId: 553611]} mnfglfflnfqlkgmtseavldnmidtialvdkdeyhfktafvnehhfskngivgapmta asfllglterlhigslnqvitthhpvriaeeaslldqmsdgrfilglsdcvsdfemdffk rqrdsqqqqfeacyeilndgittnycyanndfynfpkisinphciskenlkqyilatsmg vvewaakkglpltyrwsdtlaekenyyqryltvaaennvdithvdhqfpllvninpdrdi akqemrdyirgyiaeaypntdqeekieelikqhavgtedeyyesskyalektgsknvlls fesmknkaavidlinmvnekikk
Timeline for d6fria_: