Lineage for d6fria_ (6fri A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424945Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2424946Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (3 proteins)
    typical (beta/alpha)8-barrel fold
    heterodimer of two similar chains
  6. 2424961Protein automated matches [191049] (2 species)
    not a true protein
  7. 3050581Species Photobacterium leiognathi [TaxId:553611] [350643] (1 PDB entry)
  8. 3050658Domain d6fria_: 6fri A: [350720]
    automated match to d3fgcb_
    complexed with act

Details for d6fria_

PDB Entry: 6fri (more details), 2.3 Å

PDB Description: structure of luxb from photobacterium leiognathi
PDB Compounds: (A:) Alkanal monooxygenase beta chain

SCOPe Domain Sequences for d6fria_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fria_ c.1.16.1 (A:) automated matches {Photobacterium leiognathi [TaxId: 553611]}
mnfglfflnfqlkgmtseavldnmidtialvdkdeyhfktafvnehhfskngivgapmta
asfllglterlhigslnqvitthhpvriaeeaslldqmsdgrfilglsdcvsdfemdffk
rqrdsqqqqfeacyeilndgittnycyanndfynfpkisinphciskenlkqyilatsmg
vvewaakkglpltyrwsdtlaekenyyqryltvaaennvdithvdhqfpllvninpdrdi
akqemrdyirgyiaeaypntdqeekieelikqhavgtedeyyesskyalektgsknvlls
fesmknkaavidlinmvnekikk

SCOPe Domain Coordinates for d6fria_:

Click to download the PDB-style file with coordinates for d6fria_.
(The format of our PDB-style files is described here.)

Timeline for d6fria_:

  • d6fria_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08