Lineage for d6faeb1 (6fae B:18-177)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2447792Protein ADP-ribosylation factor [52614] (16 species)
  7. 2447837Species Human (Homo sapiens), ARL1 [TaxId:9606] [102364] (4 PDB entries)
  8. 3050654Domain d6faeb1: 6fae B:18-177 [350716]
    Other proteins in same PDB: d6faeb2
    automated match to d1upta_
    complexed with edo

Details for d6faeb1

PDB Entry: 6fae (more details), 2.35 Å

PDB Description: the sec7 domain of iqsec2 (brag1) in complex with the small gtpase arf1
PDB Compounds: (B:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d6faeb1:

Sequence, based on SEQRES records: (download)

>d6faeb1 c.37.1.8 (B:18-177) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}
mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
eitdklglhslrhrnwyiqatcatsgdglyegldwlsnql

Sequence, based on observed residues (ATOM records): (download)

>d6faeb1 c.37.1.8 (B:18-177) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}
mrilmvgldaagkttilyklktiptigfnvetveyknisftvwdvggqdkirplwrhyfq
ntqglifvvdsndrervneareelmrmlaedelrdavllvfankqnamnaaeitdklglh
slrhrnwyiqatcatsgdglyegldwlsnql

SCOPe Domain Coordinates for d6faeb1:

Click to download the PDB-style file with coordinates for d6faeb1.
(The format of our PDB-style files is described here.)

Timeline for d6faeb1:

  • d6faeb1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08