![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
![]() | Superfamily c.50.1: Macro domain-like [52949] (4 families) ![]() |
![]() | Family c.50.1.2: Macro domain [89724] (7 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
![]() | Protein automated matches [190472] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189352] (2 PDB entries) |
![]() | Domain d6fy5b_: 6fy5 B: [350715] Other proteins in same PDB: d6fy5a2 automated match to d2xd7c_ complexed with act, edo |
PDB Entry: 6fy5 (more details), 1.65 Å
SCOPe Domain Sequences for d6fy5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fy5b_ c.50.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gdgftilsskslvlgqklsltqsdishigsmrvegivhpttaeidlkedigkalekaggk efletvkelrksqgplevaeaavsqssglaakfvihchipqwgsdkceeqleetikncls aaedkklksvafppfpsgrncfpkqtaaqvtlkaisahfddssasslknvyfllfdsesi giyvqemakldak
Timeline for d6fy5b_: