Lineage for d6fy5b_ (6fy5 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459390Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2459391Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2459416Family c.50.1.2: Macro domain [89724] (7 proteins)
    found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme
  6. 2459459Protein automated matches [190472] (6 species)
    not a true protein
  7. 2459501Species Human (Homo sapiens) [TaxId:9606] [189352] (2 PDB entries)
  8. 3050653Domain d6fy5b_: 6fy5 B: [350715]
    Other proteins in same PDB: d6fy5a2
    automated match to d2xd7c_
    complexed with act, edo

Details for d6fy5b_

PDB Entry: 6fy5 (more details), 1.65 Å

PDB Description: crystal structure of the macro domain of human macroh2a2
PDB Compounds: (B:) core histone macro-h2a.2

SCOPe Domain Sequences for d6fy5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fy5b_ c.50.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdgftilsskslvlgqklsltqsdishigsmrvegivhpttaeidlkedigkalekaggk
efletvkelrksqgplevaeaavsqssglaakfvihchipqwgsdkceeqleetikncls
aaedkklksvafppfpsgrncfpkqtaaqvtlkaisahfddssasslknvyfllfdsesi
giyvqemakldak

SCOPe Domain Coordinates for d6fy5b_:

Click to download the PDB-style file with coordinates for d6fy5b_.
(The format of our PDB-style files is described here.)

Timeline for d6fy5b_:

  • d6fy5b_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08