Lineage for d6g1wb_ (6g1w B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2474357Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2474636Protein automated matches [190065] (7 species)
    not a true protein
  7. 3050597Species Tetronarce californica [TaxId:7787] [350659] (7 PDB entries)
  8. 3050643Domain d6g1wb_: 6g1w B: [350705]
    automated match to d2xupa_
    complexed with cl, e0z, nag

Details for d6g1wb_

PDB Entry: 6g1w (more details), 1.9 Å

PDB Description: crystal structure of torpedo californica acetylcholinesterase in complex with 2-{1-[2-(6-chloro-1,2,3,4-tetrahydroacridin-9-ylamino) ethyl]-1h-1,2,3-triazol-4-yl}-n-[4-(hydroxy)-3- methoxybenzyl]acetamide
PDB Compounds: (B:) acetylcholinesterase

SCOPe Domain Sequences for d6g1wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g1wb_ c.69.1.1 (B:) automated matches {Tetronarce californica [TaxId: 7787]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

SCOPe Domain Coordinates for d6g1wb_:

Click to download the PDB-style file with coordinates for d6g1wb_.
(The format of our PDB-style files is described here.)

Timeline for d6g1wb_:

  • d6g1wb_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08