Lineage for d6cmwa_ (6cmw A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542070Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2542071Superfamily d.143.1: SAICAR synthase-like [56104] (4 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. 2542128Family d.143.1.0: automated matches [191445] (1 protein)
    not a true family
  6. 2542129Protein automated matches [190664] (8 species)
    not a true protein
  7. 2542176Species Zebrafish (Danio rerio) [TaxId:7955] [319711] (4 PDB entries)
  8. 3050635Domain d6cmwa_: 6cmw A: [350697]
    automated match to d5e3sa_
    complexed with atp, ca

Details for d6cmwa_

PDB Entry: 6cmw (more details), 3.15 Å

PDB Description: crystal structure of zebrafish phosphatidylinositol-4-phosphate 5- kinase alpha isoform with bound atp/ca2+
PDB Compounds: (A:) Phosphatidylinositol-4-phosphate 5-kinase, type I, alpha

SCOPe Domain Sequences for d6cmwa_:

Sequence, based on SEQRES records: (download)

>d6cmwa_ d.143.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
ttssalkgaiqlgithsvgslsqkperdvlmqdfevvesiffpsqgssstpghhhgdfkf
ktyapiafryfremfgirpddylyslcneplielsnpgasgslfyvssddefiiktvqhk
eaeflqtllpgyfmnlnqnmrtllpkfyglycvqadgknirivvmnnllpravpmhlkfd
lkgstykrraspkerskgvptykdldfmqdmpegillendhytalsrtmqrdcrvlqsfk
imdysllvgihilhrageeastavpdtqkkgqgqkplyctaiesiqgesksktspqpyes
mggipafnskgerllvfigiidilqsyrlvkklehswkallhdgdtvsvhrpsfyadrfq
kfmcstvfrk

Sequence, based on observed residues (ATOM records): (download)

>d6cmwa_ d.143.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
ttssalkgaiqlgithsvgslsqkperdvlmqdfevvesiffpsqgssstpghhhgdfkf
ktyapiafryfremfgirpddylyslcneplielsnpgasgslfyvssddefiiktvqhk
eaeflqtllpgyfmnlnqnmrtllpkfyglycvqadgknirivvmnnllpravpmhlkfd
lkgstykrraspkerskgvptykdldfmqdmpegillendhytalsrtmqrdcrvlqsfk
imdysllvgihilhmggipafnskgerllvfigiidilqsyrtvsvhrpsfyadrfqkfm
cstvfrk

SCOPe Domain Coordinates for d6cmwa_:

Click to download the PDB-style file with coordinates for d6cmwa_.
(The format of our PDB-style files is described here.)

Timeline for d6cmwa_:

  • d6cmwa_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08