Lineage for d6fswa2 (6fsw A:89-163)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308343Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2308646Superfamily a.5.8: Hypothetical protein AF0491, middle domain [109728] (2 families) (S)
  5. 2308652Family a.5.8.0: automated matches [254275] (1 protein)
    not a true family
  6. 2308653Protein automated matches [254640] (2 species)
    not a true protein
  7. 3050629Species Archaeoglobus fulgidus [TaxId:2234] [350691] (1 PDB entry)
  8. 3050630Domain d6fswa2: 6fsw A:89-163 [350692]
    Other proteins in same PDB: d6fswa1, d6fswa3
    automated match to d1p9qc1
    complexed with peg

Details for d6fswa2

PDB Entry: 6fsw (more details), 1.9 Å

PDB Description: structure of archaeoglobus fulgidus sbds protein at 1.9 angstrom
PDB Compounds: (A:) Ribosome maturation protein SDO1-like protein

SCOPe Domain Sequences for d6fswa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fswa2 a.5.8.0 (A:89-163) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
itaeqrremleakrkqiinfisrntidprtnaphppsrieraleeakvhidifksveaqv
kdivkalkpilplkf

SCOPe Domain Coordinates for d6fswa2:

Click to download the PDB-style file with coordinates for d6fswa2.
(The format of our PDB-style files is described here.)

Timeline for d6fswa2:

  • d6fswa2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08