Lineage for d6fswa1 (6fsw A:5-88)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564863Fold d.235: FYSH domain [89894] (1 superfamily)
    beta(2)-alpha(2)-beta(2)-alpha-beta; two layers: alpha/beta; antiparallel sheet: order 51234
  4. 2564864Superfamily d.235.1: FYSH domain [89895] (3 families) (S)
  5. 2564874Family d.235.1.0: automated matches [254274] (1 protein)
    not a true family
  6. 2564875Protein automated matches [254639] (2 species)
    not a true protein
  7. 3050627Species Archaeoglobus fulgidus [TaxId:2234] [350689] (1 PDB entry)
  8. 3050628Domain d6fswa1: 6fsw A:5-88 [350690]
    Other proteins in same PDB: d6fswa2, d6fswa3
    automated match to d1p9qc2
    complexed with peg

Details for d6fswa1

PDB Entry: 6fsw (more details), 1.9 Å

PDB Description: structure of archaeoglobus fulgidus sbds protein at 1.9 angstrom
PDB Compounds: (A:) Ribosome maturation protein SDO1-like protein

SCOPe Domain Sequences for d6fswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fswa1 d.235.1.0 (A:5-88) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
sldkaviarlrkggeefevlvdpylardlkegkevnfedllaaeevfkdakkgerasvde
lrkifgtddvfeiarkiilegevq

SCOPe Domain Coordinates for d6fswa1:

Click to download the PDB-style file with coordinates for d6fswa1.
(The format of our PDB-style files is described here.)

Timeline for d6fswa1:

  • d6fswa1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08