Lineage for d6ffab_ (6ffa B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (24 species)
    not a true protein
  7. 2502649Species Human (Homo sapiens) [TaxId:9606] [187090] (80 PDB entries)
  8. 3050601Domain d6ffab_: 6ffa B: [350663]
    Other proteins in same PDB: d6ffaa_
    automated match to d2hj8a_
    complexed with gol, so4

Details for d6ffab_

PDB Entry: 6ffa (more details), 1.5 Å

PDB Description: fmdv leader protease bound to substrate isg15
PDB Compounds: (B:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d6ffab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ffab_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdeplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlpl
geyglkplstvfmnlrlx

SCOPe Domain Coordinates for d6ffab_:

Click to download the PDB-style file with coordinates for d6ffab_.
(The format of our PDB-style files is described here.)

Timeline for d6ffab_:

  • d6ffab_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08