SCOPe 2.08: Domain d6ey6j1: 6ey6 J:1-111

Lineage for d6ey6j1 (6ey6 J:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d6ey6j1: 6ey6 J:1-111 [350645]
   Other proteins in same PDB: d6ey6i2, d6ey6j2, d6ey6k2, d6ey6l2, d6ey6m2, d6ey6n2, d6ey6o2, d6ey6p2
   automated match to d4w81a_

Details for d6ey6j1

PDB Entry: 6ey6, 2.1 Å

PDB Description: c-terminal part (residues 315-516) of porm with the llama nanobody nb130

PDB Compounds: (J:) nb130

SCOPe Domain Sequences for d6ey6j1:

Sequence; same for both SEQRES and ATOM records:

>d6ey6j1 b.1.1.1 (J:1-111) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasgrtfssyvmgwfrqapgkerefvtaiswsggsihy
adsvkgrftisrdnakntvylqmnslkpedtavytcvagfagygsftsrsardsdkydyw
gqgtkvtv

Timeline for d6ey6j1:

• d6ey6j1 first appeared in SCOPe 2.07