Lineage for d6flxa_ (6flx A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (134 species)
    not a true protein
  7. 3050575Species Burkholderia pseudomallei [TaxId:272560] [350637] (1 PDB entry)
  8. 3050576Domain d6flxa_: 6flx A: [350638]
    automated match to d4wbsb_
    complexed with cl

Details for d6flxa_

PDB Entry: 6flx (more details), 2.4 Å

PDB Description: crystal structure of an abc transporter related protein from burkholderia pseudomallei
PDB Compounds: (A:) ABC transporter system, ATP-binding protein

SCOPe Domain Sequences for d6flxa_:

Sequence, based on SEQRES records: (download)

>d6flxa_ c.37.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
tsslvvrnlkkrygsrtvvkdvsldvksgevvgllgpngagkttsfymivglvpldagdi
slngspislmpihkraslglsylpqeasvfrkltveqnvravlelqhdengkrlskdaig
artealleelqiahlrenpalslsggerrrveiaralasnpsfilldepfagvdpiavle
iqkivkflkqrnigvlitdhnvretlgicdhayiisdgsvlasgapkeiienesvrrvyl
gehfrm

Sequence, based on observed residues (ATOM records): (download)

>d6flxa_ c.37.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
tsslvvrnlkkrygsrtvvkdvsldvksgevvgllgpngagkttsfymivglvpldagdi
slngspislmpihkraslglsylpqeasvfrkltveqnvravlelqhdngkrlskdaiga
rtealleelqiahlrenpalslsggerrrveiaralasnpsfilldepfagvdpiavlei
qkivkflkqrnigvlitdhnvretlgicdhayiisdgsvlasgapkeiienesvrrvylg
ehfrm

SCOPe Domain Coordinates for d6flxa_:

Click to download the PDB-style file with coordinates for d6flxa_.
(The format of our PDB-style files is described here.)

Timeline for d6flxa_:

  • d6flxa_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08