Lineage for d6fahd2 (6fah D:228-379)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2317865Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2317999Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2318000Protein automated matches [226935] (27 species)
    not a true protein
  7. 3050507Species Acetobacterium woodii [TaxId:931626] [350569] (1 PDB entry)
  8. 3050567Domain d6fahd2: 6fah D:228-379 [350629]
    Other proteins in same PDB: d6fahb_, d6fahc1, d6fahd1, d6fahf_
    automated match to d2d29a1
    complexed with fad, sf4, so4

Details for d6fahd2

PDB Entry: 6fah (more details), 3.13 Å

PDB Description: molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction
PDB Compounds: (D:) Caffeyl-CoA reductase-Etf complex subunit CarC

SCOPe Domain Sequences for d6fahd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fahd2 a.29.3.0 (D:228-379) automated matches {Acetobacterium woodii [TaxId: 931626]}
nkgfsnamktldvgrlgvasqsigvaqgaldeaikyakerkqfgkriadfqaiafmiadm
atkleaakllvynaaslmdnkknatkeasmakfyaseicneicakavqihggygyikeyk
vermyrdcrvftiyegtsqvqqmvisgmllkk

SCOPe Domain Coordinates for d6fahd2:

Click to download the PDB-style file with coordinates for d6fahd2.
(The format of our PDB-style files is described here.)

Timeline for d6fahd2:

  • d6fahd2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08