Lineage for d6ffaa_ (6ffa A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2497580Family d.3.1.2: FMDV leader protease [54037] (2 proteins)
    automatically mapped to Pfam PF05408
  6. 2497596Protein automated matches [254558] (3 species)
    not a true protein
  7. 3050561Species Foot-and-mouth disease virus [TaxId:12110] [350623] (1 PDB entry)
  8. 3050562Domain d6ffaa_: 6ffa A: [350624]
    Other proteins in same PDB: d6ffab_
    automated match to d1qola_
    complexed with gol, so4

Details for d6ffaa_

PDB Entry: 6ffa (more details), 1.5 Å

PDB Description: fmdv leader protease bound to substrate isg15
PDB Compounds: (A:) Lbpro

SCOPe Domain Sequences for d6ffaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ffaa_ d.3.1.2 (A:) automated matches {Foot-and-mouth disease virus [TaxId: 12110]}
meltlyngekktfysrpnnhdncwlnailqlfryveepffdwvysspenltleaikqled
ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh
avfacvtsngwyaiddedfypwtpdpsdvlvfvpyd

SCOPe Domain Coordinates for d6ffaa_:

Click to download the PDB-style file with coordinates for d6ffaa_.
(The format of our PDB-style files is described here.)

Timeline for d6ffaa_:

  • d6ffaa_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08