Lineage for d6ey0g1 (6ey0 G:1-111)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2357712Species Llama (Lama glama) [TaxId:9844] [189241] (14 PDB entries)
  8. 3050559Domain d6ey0g1: 6ey0 G:1-111 [350621]
    Other proteins in same PDB: d6ey0e2, d6ey0f2, d6ey0g2, d6ey0h2
    automated match to d3cx5j_

Details for d6ey0g1

PDB Entry: 6ey0 (more details), 2.4 Å

PDB Description: n-terminal part (residues 30-212) of porm with the llama nanobody nb01
PDB Compounds: (G:) llama nanobody nb01

SCOPe Domain Sequences for d6ey0g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ey0g1 b.1.1.0 (G:1-111) automated matches {Llama (Lama glama) [TaxId: 9844]}
dvqlvesggglvqaggslrvscaasgrtfssysmgwfrqapgkerefvaaisrsdnstyy
adsvkgrftisrdsakntvylqmnslkpedtavyycaatpygsryylrelreydywgqgt
qvtv

SCOPe Domain Coordinates for d6ey0g1:

Click to download the PDB-style file with coordinates for d6ey0g1.
(The format of our PDB-style files is described here.)

Timeline for d6ey0g1:

  • d6ey0g1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08