Lineage for d6fict1 (6fic T:1377-1497)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topologySuperfamily a.29.2: Bromodomain [47370] (2 families) 
Family a.29.2.1: Bromodomain [47371] (6 proteins) 
Protein TAFII250 double bromodomain module [47377] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47378] (2 PDB entries) 
Domain d6fict1: 6fic T:1377-1497 [350619]
automated match to d1eqfa1
complexed with dkh
Details for d6fict1
PDB Entry: 6fic (more details), 2.18 Å
PDB Description: bivalent inhibitor unc4512 bound to the taf1 bromodomain tandem
PDB Compounds: (T:) Transcription initiation factor TFIID subunit 1SCOPe Domain Sequences for d6fict1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fict1 a.29.2.1 (T:1377-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]}
rrtdpmvtlssilesiindmrdlpntypfhtpvnakvvkdyykiitrpmdlqtlrenvrk
rlypsreefrehlelivknsatyngpkhsltqisqsmldlcdeklkekedklarlekain
p
SCOPe Domain Coordinates for d6fict1:
Click to download the PDB-style file with coordinates for d6fict1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6fict1:
- d6fict1 is new in SCOPe 2.07-stable
- d6fict1 appears in the current release, SCOPe 2.08
View in 3D
