Lineage for d6fklb1 (6fkl B:1-245)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445289Species Cow (Bos taurus) [TaxId:9913] [226564] (50 PDB entries)
  8. 3050554Domain d6fklb1: 6fkl B:1-245 [350616]
    Other proteins in same PDB: d6fkla2, d6fklb2, d6fklc2, d6fkld2, d6fkle_, d6fklf1, d6fklf2, d6fklf3
    automated match to d4drxb1
    complexed with acp, ca, dlk, gdp, gol, gtp, mes, mg

Details for d6fklb1

PDB Entry: 6fkl (more details), 2.1 Å

PDB Description: tubulin-tub015 complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6fklb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fklb1 c.32.1.1 (B:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d6fklb1:

Click to download the PDB-style file with coordinates for d6fklb1.
(The format of our PDB-style files is described here.)

Timeline for d6fklb1:

  • d6fklb1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08