Lineage for d6f7ua2 (6f7u A:122-156)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587451Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (2 families) (S)
    automatically mapped to Pfam PF05191
  5. 2587452Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 2587453Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (9 species)
  7. 2587477Species Escherichia coli [TaxId:562] [57778] (9 PDB entries)
    contains a rudiment form of the domain that lacks zn-binding site
  8. 3050546Domain d6f7ua2: 6f7u A:122-156 [350608]
    Other proteins in same PDB: d6f7ua1
    automated match to d1akea2
    complexed with gcp, mg

Details for d6f7ua2

PDB Entry: 6f7u (more details), 1.4 Å

PDB Description: molecular mechanism of atp versus gtp selectivity of adenylate kinase
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d6f7ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f7ua2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

SCOPe Domain Coordinates for d6f7ua2:

Click to download the PDB-style file with coordinates for d6f7ua2.
(The format of our PDB-style files is described here.)

Timeline for d6f7ua2:

  • d6f7ua2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6f7ua1