Lineage for d6f7ua1 (6f7u A:1-121,A:157-214)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2446889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2446894Protein Adenylate kinase [52554] (16 species)
  7. 2446918Species Escherichia coli [TaxId:562] [52560] (9 PDB entries)
    contains a rudiment "zinc-finger" subdomain, residue 122-156
  8. 3050545Domain d6f7ua1: 6f7u A:1-121,A:157-214 [350607]
    Other proteins in same PDB: d6f7ua2
    automated match to d1akea1
    complexed with gcp, mg

Details for d6f7ua1

PDB Entry: 6f7u (more details), 1.4 Å

PDB Description: molecular mechanism of atp versus gtp selectivity of adenylate kinase
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d6f7ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f7ua1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

SCOPe Domain Coordinates for d6f7ua1:

Click to download the PDB-style file with coordinates for d6f7ua1.
(The format of our PDB-style files is described here.)

Timeline for d6f7ua1:

  • d6f7ua1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6f7ua2