Lineage for d6fkwd_ (6fkw D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399926Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2399927Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2399980Family b.70.1.0: automated matches [227985] (1 protein)
    not a true family
  6. 2399981Protein automated matches [227986] (3 species)
    not a true protein
  7. 2399985Species Methylacidiphilum fumariolicum [TaxId:1156937] [227987] (2 PDB entries)
  8. 3050536Domain d6fkwd_: 6fkw D: [350598]
    automated match to d4maea_
    complexed with eu, pqq

Details for d6fkwd_

PDB Entry: 6fkw (more details), 1.4 Å

PDB Description: europium-containing methanol dehydrogenase
PDB Compounds: (D:) methanol dehydrogenase

SCOPe Domain Sequences for d6fkwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fkwd_ b.70.1.0 (D:) automated matches {Methylacidiphilum fumariolicum [TaxId: 1156937]}
ndeliklekepgqwvmqnknyantryselnqintknvsrlrlawsfstgalrgheggplv
vgttmyvhsaypnhvyaldltqkpyaikwqytpvqnsqavavaccdvvnrglayangkif
mttldgqiialdantgkelwkmkhadvtkgetitgaplvvkdkvlvgvsggefgvrgrvg
aydintgnrvwlaysqgpdeevlldsdfnkefpqhggpgdgtktwpgeqwklgggttwgw
ysydpaldlfyygtsnpgtwnaeqrkggdnkwsctifarrpdtgkarwayqmtpwdswdy
dgvnemilpdltvkgkktpclvhfdrngfgyvldrrtgqlieaqpfvyvnwakeiskend
rpveipekrtkqgvdtkgicpnsmggkdqqpaafspqtglfyvptnnmcmnyegveatyt
agapyvganvlmysghegkddyygaficydalkgkrvweihehfpvwsgpvvtagglafy
gtmdgwfkavdiktgkvlwqqklgsgiignpitflgpdkkqyvavysgvggwfgiavaqn
lppddpyaglgavgvayqaglpkattvggelyvfal

SCOPe Domain Coordinates for d6fkwd_:

Click to download the PDB-style file with coordinates for d6fkwd_.
(The format of our PDB-style files is described here.)

Timeline for d6fkwd_:

  • d6fkwd_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08