Lineage for d6faxl2 (6fax L:107-211)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (798 PDB entries)
  8. 3050532Domain d6faxl2: 6fax L:107-211 [350594]
    Other proteins in same PDB: d6faxl1
    automated match to d1dn0a2

Details for d6faxl2

PDB Entry: 6fax (more details), 2.99 Å

PDB Description: complex of human cd40 ectodomain with lob 7.4 fab
PDB Compounds: (L:) Lob 7.4 light chain

SCOPe Domain Sequences for d6faxl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6faxl2 b.1.1.2 (L:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d6faxl2:

Click to download the PDB-style file with coordinates for d6faxl2.
(The format of our PDB-style files is described here.)

Timeline for d6faxl2:

  • d6faxl2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08