Lineage for d6fahf_ (6fah F:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2443548Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2443822Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2443823Protein automated matches [190116] (26 species)
    not a true protein
  7. 3050476Species Acetobacterium woodii [TaxId:931626] [350538] (1 PDB entry)
  8. 3050530Domain d6fahf_: 6fah F: [350592]
    Other proteins in same PDB: d6fahc1, d6fahc2, d6fahd1, d6fahd2
    automated match to d5ol2b_
    complexed with fad, sf4, so4

Details for d6fahf_

PDB Entry: 6fah (more details), 3.13 Å

PDB Description: molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction
PDB Compounds: (F:) Caffeyl-CoA reductase-Etf complex subunit CarD

SCOPe Domain Sequences for d6fahf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fahf_ c.26.2.0 (F:) automated matches {Acetobacterium woodii [TaxId: 931626]}
mrilvcakqvpdtnevkidpktgtmiregvpsilnpddanaleaalvikdenpgtevivm
tmgppqasemlreclamgadeayllsdrafggadtwatsatlaagikkvkkvdlvlagrq
aidgdtaqvgsqiaqrlkmpvvtyvedikiedkkaivhrqmedgyevievqlpclltcvk
elndprymsvggimdayeqpitiwnhediglspeacglnasptqvfrsfsppakgggemi
tgttvnevagslvsklkekhii

SCOPe Domain Coordinates for d6fahf_:

Click to download the PDB-style file with coordinates for d6fahf_.
(The format of our PDB-style files is described here.)

Timeline for d6fahf_:

  • d6fahf_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08