Lineage for d6fgja_ (6fgj A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563564Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2563565Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2564030Family d.218.1.0: automated matches [227287] (1 protein)
    not a true family
  6. 2564031Protein automated matches [227105] (5 species)
    not a true protein
  7. 3050493Species Staphylococcus aureus [TaxId:1280] [350555] (4 PDB entries)
  8. 3050527Domain d6fgja_: 6fgj A: [350589]
    automated match to d5f2vq_
    complexed with pge

Details for d6fgja_

PDB Entry: 6fgj (more details), 2.25 Å

PDB Description: crystal structure of the small alarmone synthethase 2 from staphylococcus aureus
PDB Compounds: (A:) GTP pyrophosphokinase

SCOPe Domain Sequences for d6fgja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fgja_ d.218.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
dtllgfveldhiyssalkeistklsilddnfnhiykhnpihhmerrvkemrslieklnrk
glqisaetakehildiagirvvcnylddiylieemllkqedvqlikrkdyiqhpkengyr
slhivvsipvflaervevlpveiqirtigmdmwaslehkiryknnaetekyrdllkecat
eitevedklqqihseit

SCOPe Domain Coordinates for d6fgja_:

Click to download the PDB-style file with coordinates for d6fgja_.
(The format of our PDB-style files is described here.)

Timeline for d6fgja_:

  • d6fgja_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08