Lineage for d6f9va_ (6f9v A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530208Species Human (Homo sapiens) [TaxId:9606] [188286] (55 PDB entries)
  8. 3050519Domain d6f9va_: 6f9v A: [350581]
    automated match to d6en5d_
    complexed with bma, cl, d0z, edo, fuc, man, mg, nag, p33, peg, pg4, pge, zn

Details for d6f9va_

PDB Entry: 6f9v (more details), 1.69 Å

PDB Description: crystal structure of human angiotensin-1 converting enzyme n-domain in complex with sampatrilat.
PDB Compounds: (A:) angiotensin-converting enzyme

SCOPe Domain Sequences for d6f9va_:

Sequence, based on SEQRES records: (download)

>d6f9va_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
iystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
pplpdnype

Sequence, based on observed residues (ATOM records): (download)

>d6f9va_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
iystakvclatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftalsne
aykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryinl
rgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeefftsl
elspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhemg
hiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdiny
llkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrnethf
dagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrkvl
ragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwhpplp
dnype

SCOPe Domain Coordinates for d6f9va_:

Click to download the PDB-style file with coordinates for d6f9va_.
(The format of our PDB-style files is described here.)

Timeline for d6f9va_:

  • d6f9va_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08