Lineage for d6fahc1 (6fah C:1-227)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570412Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2570413Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2570558Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2570559Protein automated matches [226934] (26 species)
    not a true protein
  7. 3050505Species Acetobacterium woodii [TaxId:931626] [350567] (1 PDB entry)
  8. 3050506Domain d6fahc1: 6fah C:1-227 [350568]
    Other proteins in same PDB: d6fahb_, d6fahc2, d6fahd2, d6fahf_
    automated match to d2cx9a2
    complexed with fad, sf4, so4

Details for d6fahc1

PDB Entry: 6fah (more details), 3.13 Å

PDB Description: molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction
PDB Compounds: (C:) Caffeyl-CoA reductase-Etf complex subunit CarC

SCOPe Domain Sequences for d6fahc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fahc1 e.6.1.0 (C:1-227) automated matches {Acetobacterium woodii [TaxId: 931626]}
myfseqnkmirklardfaekeltteildeveesgefpqeildkmakfgffgikipkslgg
sggdhmsyvicmeefarvsgvasvylsspnslaggplllsgteeqiekylkpiitgkkkl
afaltepgagsdaggmsttavdmgdyyllngrktfitmaplcddaviyaktdmskgtrgi
safivdlksegvsmgknehkmgligcatsdiimedvkvpkenrlgev

SCOPe Domain Coordinates for d6fahc1:

Click to download the PDB-style file with coordinates for d6fahc1.
(The format of our PDB-style files is described here.)

Timeline for d6fahc1:

  • d6fahc1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08